Lineage for d2ila__ (2ila -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins) 
Protein Interleukin-1alpha [50368] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50369] (1 PDB entry) 
Domain d2ila__: 2ila - [25560]
Details for d2ila__
PDB Entry: 2ila (more details), 2.3 Å
PDB Description: structure of interleukin 1alpha at 2.7-angstroms resolution
SCOP Domain Sequences for d2ila__:
Sequence, based on SEQRES records: (download)
>d2ila__ b.42.1.2 (-) Interleukin-1alpha {Human (Homo sapiens)}
nvkynfmriikyefilndalnqsiiranaqyltaaalhnldeavkfdmgayksskddaki
tvilrisktqlyvtaqdedqpvllkempeipktitgsetnllffwethgtknyftsvahp
nlfiatkqdywvclaggppsitdfqile
Sequence, based on observed residues (ATOM records): (download)
>d2ila__ b.42.1.2 (-) Interleukin-1alpha {Human (Homo sapiens)}
nvkynfmriikyefilndalnqsiiranaqyltaaalhnldeavkfdmgaykssakitvi
lrisktqlyvtaqdedqpvllkempeipktitgsetnllffwethgtknyftsvahpnlf
iatkqdywvclaggppsitdfqile
SCOP Domain Coordinates for d2ila__:
Click to download the PDB-style file with coordinates for d2ila__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ila__:
- d2ila__ appears in SCOP 1.57
- d2ila__ appears in the current release, SCOPe 2.08, called d2ilaa_
View in 3D