Lineage for d1irp__ (1irp -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins) 
Protein Interleukin-1 receptor antagonist protein [50366] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries) 
Domain d1irp__: 1irp - [25559]
Details for d1irp__
PDB Entry: 1irp (more details)
PDB Description: solution structure of human interleukin-1 receptor antagonist protein
SCOP Domain Sequences for d1irp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1irp__ b.42.1.2 (-) Interleukin-1 receptor antagonist protein {Human (Homo sapiens)}
mrpsgrksskmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflg
ihggkmclscvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgw
flctameadqpvsltnmpdegvmvtkfyfqede
SCOP Domain Coordinates for d1irp__:
Click to download the PDB-style file with coordinates for d1irp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1irp__:
- d1irp__ appears in SCOP 1.57
- d1irp__ appears in the current release, SCOPe 2.08, called d1irpa1
View in 3D