SCOP 1.67: Domain d2irtb_: 2irt B:

Lineage for d2irtb_ (2irt B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)

6. Protein Interleukin-1 receptor antagonist protein [50366] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries)

8. Domain d2irtb_: 2irt B: [25558]
   CA-atoms only

Details for d2irtb_

PDB Entry: 2irt, 3.2 Å

PDB Description: initial crystallographic analyses of a recombinant interleukin-1 receptor antagonist protein

SCOP Domain Sequences for d2irtb_:

Sequence; same for both SEQRES and ATOM records:

>d2irtb_ b.42.1.2 (B:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens)}
skmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmcl
scvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctamea
dqpvsltnmpdegvmvtkfyfqede

Timeline for d2irtb_:

• d2irtb_ first appeared (with stable ids) in SCOP 1.55
  
• d2irtb_ appears in SCOP 1.65
  
• d2irtb_ appears in SCOP 1.69
  
• d2irtb_ appears in the current release, SCOPe 2.08