Lineage for d1irax_ (1ira X:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14402Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 14463Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins)
  6. 14464Protein Interleukin-1 receptor antagonist protein [50366] (1 species)
  7. 14465Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries)
  8. 14470Domain d1irax_: 1ira X: [25556]
    Other proteins in same PDB: d1iray1, d1iray2, d1iray3

Details for d1irax_

PDB Entry: 1ira (more details), 2.7 Å

PDB Description: complex of the interleukin-1 receptor with the interleukin-1 receptor antagonist (il1ra)

SCOP Domain Sequences for d1irax_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irax_ b.42.1.2 (X:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens)}
sskmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmc
lscvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctame
adqpvsltnmpdegvmvtkfyfqed

SCOP Domain Coordinates for d1irax_:

Click to download the PDB-style file with coordinates for d1irax_.
(The format of our PDB-style files is described here.)

Timeline for d1irax_: