Lineage for d1iltb_ (1ilt B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins) 
Protein Interleukin-1 receptor antagonist protein [50366] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries) 
Domain d1iltb_: 1ilt B: [25555]
Details for d1iltb_
PDB Entry: 1ilt (more details), 2 Å
PDB Description: x-ray structure of interleukin-1 receptor antagonist at 2.0 angstroms resolution
SCOP Domain Sequences for d1iltb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iltb_ b.42.1.2 (B:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens)}
mqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmclsc
vksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctameadq
pvsltnmpdegvmvtkfyfqede
SCOP Domain Coordinates for d1iltb_:
Click to download the PDB-style file with coordinates for d1iltb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iltb_:
- d1iltb_ appears in SCOP 1.57
- d1iltb_ appears in the current release, SCOPe 2.08
View in 3D
