Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein Interleukin-1 receptor antagonist protein [50366] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries) |
Domain d1iltb_: 1ilt B: [25555] CA-atoms only |
PDB Entry: 1ilt (more details)
SCOPe Domain Sequences for d1iltb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iltb_ b.42.1.2 (B:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens) [TaxId: 9606]} mqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmclsc vksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctameadq pvsltnmpdegvmvtkfyfqede
Timeline for d1iltb_: