Lineage for d1ilta_ (1ilt A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375318Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 375446Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)
  6. 375447Protein Interleukin-1 receptor antagonist protein [50366] (1 species)
  7. 375448Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries)
  8. 375452Domain d1ilta_: 1ilt A: [25554]

Details for d1ilta_

PDB Entry: 1ilt (more details), 2 Å

PDB Description: x-ray structure of interleukin-1 receptor antagonist at 2.0 angstroms resolution

SCOP Domain Sequences for d1ilta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilta_ b.42.1.2 (A:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens)}
mqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmclsc
vksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctameadq
pvsltnmpdegvmvtkfyfqede

SCOP Domain Coordinates for d1ilta_:

Click to download the PDB-style file with coordinates for d1ilta_.
(The format of our PDB-style files is described here.)

Timeline for d1ilta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iltb_