Lineage for d1ilta_ (1ilt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791924Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2791925Protein Interleukin-1 receptor antagonist protein [50366] (1 species)
  7. 2791926Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries)
  8. 2791933Domain d1ilta_: 1ilt A: [25554]
    CA-atoms only

Details for d1ilta_

PDB Entry: 1ilt (more details)

PDB Description: x-ray structure of interleukin-1 receptor antagonist at 2.0 angstroms resolution
PDB Compounds: (A:) interleukin-1 receptor antagonist

SCOPe Domain Sequences for d1ilta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilta_ b.42.1.2 (A:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens) [TaxId: 9606]}
mqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmclsc
vksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctameadq
pvsltnmpdegvmvtkfyfqede

SCOPe Domain Coordinates for d1ilta_:

Click to download the PDB-style file with coordinates for d1ilta_.
(The format of our PDB-style files is described here.)

Timeline for d1ilta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iltb_