Lineage for d1ilr1_ (1ilr 1:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (3 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) 
Protein Interleukin-1 receptor antagonist protein [50366] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries) 
Domain d1ilr1_: 1ilr 1: [25552]
Details for d1ilr1_
PDB Entry: 1ilr (more details), 2.1 Å
PDB Description: crystal structure of the interleukin-1 receptor antagonist
PDB Compounds: (1:) interleukin-1 receptor antagonist proteinSCOPe Domain Sequences for d1ilr1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ilr1_ b.42.1.2 (1:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens) [TaxId: 9606]}
skmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmcl
scvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctamea
dqpvsltnmpdegvmvtkfyfqede
SCOPe Domain Coordinates for d1ilr1_:
Click to download the PDB-style file with coordinates for d1ilr1_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ilr1_:
- d1ilr1_ first appeared (with stable ids) in SCOP 1.55
- d1ilr1_ appears in SCOPe 2.07
View in 3D
