SCOP 1.67: Domain d2mib__: 2mib -

Lineage for d2mib__ (2mib -)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins)

6. Protein Interleukin-1beta [50363] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50365] (2 PDB entries)

8. Domain d2mib__: 2mib - [25551]

Details for d2mib__

PDB Entry: 2mib, 2.84 Å

PDB Description: the structure of murine interleukin-1 beta at 2.8 angstroms resolution

SCOP Domain Sequences for d2mib__:

Sequence; same for both SEQRES and ATOM records:

>d2mib__ b.42.1.2 (-) Interleukin-1beta {Mouse (Mus musculus)}
irqlhyrlrdeqqkslvlsdpyelkalhlngqninqqvifsmsfvqgepsndkipvalgl
kgknlylscvmkdgtptlqlesvdpkqypkkkmekrfvfnkievkskvefesaefpnwyi
stsqaehkpvflgnnsgqdiidftmesvs

Timeline for d2mib__:

• d2mib__ first appeared (with stable ids) in SCOP 1.55
  
• d2mib__ appears in SCOP 1.65
  
• d2mib__ appears in SCOP 1.69
  
• d2mib__ appears in the current release, SCOPe 2.08, called d2miba_