Lineage for d6i1b__ (6i1b -)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.42: beta-Trefoil [50352] (6 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins) Protein Interleukin-1beta [50363] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50364] (15 PDB entries) 
Domain d6i1b__: 6i1b - [25548]
Details for d6i1b__
PDB Entry: 6i1b (more details)
PDB Description: high-resolution three-dimensional structure of interleukin-1 beta in solution by three-and four-dimensional nuclear magnetic resonance spectroscopy
SCOP Domain Sequences for d6i1b__:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i1b__ b.42.1.2 (-) Interleukin-1beta {Human (Homo sapiens)}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss
SCOP Domain Coordinates for d6i1b__:
Click to download the PDB-style file with coordinates for d6i1b__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6i1b__:
- d6i1b__ first appeared (with stable ids) in SCOP 1.55
- d6i1b__ appears in SCOP 1.65
- d6i1b__ appears in SCOP 1.69
- d6i1b__ appears in the current release, SCOPe 2.08, called d6i1ba_
View in 3D