Lineage for d1iob__ (1iob -)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetrySuperfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (5 proteins) Protein Interleukin-1beta [50363] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50364] (19 PDB entries) 
Domain d1iob__: 1iob - [25547]
Details for d1iob__
PDB Entry: 1iob (more details), 2 Å
PDB Description: interleukin-1 beta from joint x-ray and nmr refinement
SCOP Domain Sequences for d1iob__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iob__ b.42.1.2 (-) Interleukin-1beta {Human (Homo sapiens)}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss
SCOP Domain Coordinates for d1iob__:
Click to download the PDB-style file with coordinates for d1iob__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iob__:
- d1iob__ first appeared (with stable ids) in SCOP 1.55
- d1iob__ appears in SCOP 1.69
- d1iob__ is called d1ioba_ in SCOP 1.73
- d1iob__ appears in the current release, SCOPe 2.08, called d1ioba_
View in 3D