Lineage for d1itba_ (1itb A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298063Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 298064Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 298169Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins)
  6. 298183Protein Interleukin-1beta [50363] (2 species)
  7. 298184Species Human (Homo sapiens) [TaxId:9606] [50364] (14 PDB entries)
  8. 298194Domain d1itba_: 1itb A: [25546]
    Other proteins in same PDB: d1itbb1, d1itbb2, d1itbb3

Details for d1itba_

PDB Entry: 1itb (more details), 2.5 Å

PDB Description: type-1 interleukin-1 receptor complexed with interleukin-1 beta

SCOP Domain Sequences for d1itba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itba_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens)}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss

SCOP Domain Coordinates for d1itba_:

Click to download the PDB-style file with coordinates for d1itba_.
(The format of our PDB-style files is described here.)

Timeline for d1itba_: