SCOPe 2.08: Domain d41bia_: 41bi A:

Lineage for d41bia_ (41bi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)

6. Protein Interleukin-1beta [50363] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50364] (53 PDB entries)
   Uniprot P01584 117-269

8. Domain d41bia_: 41bi A: [25545]
   mutant

Details for d41bia_

PDB Entry: 41bi, 2.9 Å

PDB Description: interleukin-1 beta (il-1 beta) (mutant with cys 8 replaced by ala (c8a)

PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d41bia_:

Sequence; same for both SEQRES and ATOM records:

>d41bia_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnatlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvss

Timeline for d41bia_:

• d41bia_ first appeared (with stable ids) in SCOP 1.55, called d41bi__
  
• d41bia_ appears in SCOPe 2.07