Lineage for d9ilba_ (9ilb A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791924Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2791952Protein Interleukin-1beta [50363] (2 species)
  7. 2791953Species Human (Homo sapiens) [TaxId:9606] [50364] (53 PDB entries)
    Uniprot P01584 117-269
  8. 2791983Domain d9ilba_: 9ilb A: [25543]

Details for d9ilba_

PDB Entry: 9ilb (more details), 2.28 Å

PDB Description: human interleukin-1 beta
PDB Compounds: (A:) protein (human interleukin-1 beta)

SCOPe Domain Sequences for d9ilba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d9ilba_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvss

SCOPe Domain Coordinates for d9ilba_:

Click to download the PDB-style file with coordinates for d9ilba_.
(The format of our PDB-style files is described here.)

Timeline for d9ilba_: