Lineage for d21bia_ (21bi A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061773Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2061801Protein Interleukin-1beta [50363] (2 species)
  7. 2061802Species Human (Homo sapiens) [TaxId:9606] [50364] (26 PDB entries)
    Uniprot P01584 117-269
  8. 2061815Domain d21bia_: 21bi A: [25542]
    mutant

Details for d21bia_

PDB Entry: 21bi (more details), 2 Å

PDB Description: interleukin-1 beta (il-1 beta) (mutant with cys 71 replaced by ala) (c71a)
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d21bia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d21bia_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylsavlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvss

SCOPe Domain Coordinates for d21bia_:

Click to download the PDB-style file with coordinates for d21bia_.
(The format of our PDB-style files is described here.)

Timeline for d21bia_: