Lineage for d21bi__ (21bi -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins) Protein Interleukin-1beta [50363] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50364] (13 PDB entries) 
Domain d21bi__: 21bi - [25542]
Details for d21bi__
PDB Entry: 21bi (more details), 2 Å
PDB Description: interleukin-1 beta (il-1 beta) (mutant with cys 71 replaced by ala) (c71a)
SCOP Domain Sequences for d21bi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d21bi__ b.42.1.2 (-) Interleukin-1beta {Human (Homo sapiens)}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylsavlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvss
SCOP Domain Coordinates for d21bi__:
Click to download the PDB-style file with coordinates for d21bi__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d21bi__:
- d21bi__ appears in SCOP 1.57
- d21bi__ appears in the current release, SCOPe 2.08, called d21bia_
View in 3D