Lineage for d5i1b__ (5i1b -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14402Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 14463Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins)
  6. 14477Protein Interleukin-1beta [50363] (2 species)
  7. 14478Species Human (Homo sapiens) [TaxId:9606] [50364] (13 PDB entries)
  8. 14481Domain d5i1b__: 5i1b - [25539]

Details for d5i1b__

PDB Entry: 5i1b (more details), 2.1 Å

PDB Description: a comparison of the high resolution structures of human and murine interleukin-1b

SCOP Domain Sequences for d5i1b__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i1b__ b.42.1.2 (-) Interleukin-1beta {Human (Homo sapiens)}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvss

SCOP Domain Coordinates for d5i1b__:

Click to download the PDB-style file with coordinates for d5i1b__.
(The format of our PDB-style files is described here.)

Timeline for d5i1b__: