Lineage for d1i1ba_ (1i1b A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2384843Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2385158Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 protein domains)
  6. 2385186Protein Interleukin-1beta [50363] (2 species)
  7. 2385187Species Human (Homo sapiens) [TaxId:9606] [50364] (26 PDB entries)
    Uniprot P01584 117-269
  8. 2385200Domain d1i1ba_: 1i1b A: [25537]

Details for d1i1ba_

PDB Entry: 1i1b (more details), 2 Å

PDB Description: crystal structure of recombinant human interleukin-1beta at 2.0 angstroms resolution
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d1i1ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i1ba_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvss

SCOPe Domain Coordinates for d1i1ba_:

Click to download the PDB-style file with coordinates for d1i1ba_.
(The format of our PDB-style files is described here.)

Timeline for d1i1ba_: