SCOPe 2.07: Domain d1qqkb_: 1qqk B:

Lineage for d1qqkb_ (1qqk B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Keratinocyte growth factor, FGF7 [50360] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries)

8. Domain d1qqkb_: 1qqk B: [25536]

Details for d1qqkb_

PDB Entry: 1qqk, 3.1 Å

PDB Description: the crystal structure of fibroblast growth factor 7 (keratinocyte growth factor)

PDB Compounds: (B:) fibroblast growth factor 7

SCOPe Domain Sequences for d1qqkb_:

Sequence, based on SEQRES records:

>d1qqkb_ b.42.1.1 (B:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwthsggemfvalnqkglpvkgkktkke
qktahflpmai

Sequence, based on observed residues (ATOM records):

>d1qqkb_ b.42.1.1 (B:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
klyakkecnedcnfkelilenhyntyasakwthsmfvalnqkglpvkgkktkkeqktahf
lpmai

Timeline for d1qqkb_:

• d1qqkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qqkb_ appears in SCOPe 2.06
  
• d1qqkb_ appears in the current release, SCOPe 2.08