Lineage for d1qqkb_ (1qqk B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59853Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 59854Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 59929Protein Keratinocyte growth factor, FGF7 [50360] (1 species)
  7. 59930Species Rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries)
  8. 59932Domain d1qqkb_: 1qqk B: [25536]

Details for d1qqkb_

PDB Entry: 1qqk (more details), 3.1 Å

PDB Description: the crystal structure of fibroblast growth factor 7 (keratinocyte growth factor)

SCOP Domain Sequences for d1qqkb_:

Sequence, based on SEQRES records: (download)

>d1qqkb_ b.42.1.1 (B:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus)}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwthsggemfvalnqkglpvkgkktkke
qktahflpmai

Sequence, based on observed residues (ATOM records): (download)

>d1qqkb_ b.42.1.1 (B:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus)}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
klyakkecnedcnfkelilenhyntyasakwthsmfvalnqkglpvkgkktkkeqktahf
lpmai

SCOP Domain Coordinates for d1qqkb_:

Click to download the PDB-style file with coordinates for d1qqkb_.
(The format of our PDB-style files is described here.)

Timeline for d1qqkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qqka_