Lineage for d1qqka_ (1qqk A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298063Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 298064Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 298065Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins)
  6. 298164Protein Keratinocyte growth factor, FGF7 [50360] (1 species)
  7. 298165Species Rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries)
  8. 298166Domain d1qqka_: 1qqk A: [25535]

Details for d1qqka_

PDB Entry: 1qqk (more details), 3.1 Å

PDB Description: the crystal structure of fibroblast growth factor 7 (keratinocyte growth factor)

SCOP Domain Sequences for d1qqka_:

Sequence, based on SEQRES records: (download)

>d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus)}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwthsggemfvalnqkglpvkgkktkke
qktahflpmait

Sequence, based on observed residues (ATOM records): (download)

>d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus)}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwggemfvalnqkglpvkgkktkkeqkt
ahflpmait

SCOP Domain Coordinates for d1qqka_:

Click to download the PDB-style file with coordinates for d1qqka_.
(The format of our PDB-style files is described here.)

Timeline for d1qqka_: