Lineage for d1qqka_ (1qqk A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (3 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) 
Protein Keratinocyte growth factor, FGF7 [50360] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries) 
Domain d1qqka_: 1qqk A: [25535]
Details for d1qqka_
PDB Entry: 1qqk (more details), 3.1 Å
PDB Description: the crystal structure of fibroblast growth factor 7 (keratinocyte growth factor)
PDB Compounds: (A:) fibroblast growth factor 7SCOPe Domain Sequences for d1qqka_:
Sequence, based on SEQRES records: (download)
>d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwthsggemfvalnqkglpvkgkktkke
qktahflpmait
Sequence, based on observed residues (ATOM records): (download)
>d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwggemfvalnqkglpvkgkktkkeqkt
ahflpmait
SCOPe Domain Coordinates for d1qqka_:
Click to download the PDB-style file with coordinates for d1qqka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qqka_:
- d1qqka_ first appeared (with stable ids) in SCOP 1.55
- d1qqka_ appears in SCOPe 2.07
View in 3D
