Lineage for d1qqka_ (1qqk A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2384843Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2384844Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 protein domains)
  6. 2385135Protein Keratinocyte growth factor, FGF7 [50360] (1 species)
  7. 2385136Species Norway rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries)
  8. 2385137Domain d1qqka_: 1qqk A: [25535]

Details for d1qqka_

PDB Entry: 1qqk (more details), 3.1 Å

PDB Description: the crystal structure of fibroblast growth factor 7 (keratinocyte growth factor)
PDB Compounds: (A:) fibroblast growth factor 7

SCOPe Domain Sequences for d1qqka_:

Sequence, based on SEQRES records: (download)

>d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwthsggemfvalnqkglpvkgkktkke
qktahflpmait

Sequence, based on observed residues (ATOM records): (download)

>d1qqka_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakkecnedcnfkelilenhyntyasakwggemfvalnqkglpvkgkktkkeqkt
ahflpmait

SCOPe Domain Coordinates for d1qqka_:

Click to download the PDB-style file with coordinates for d1qqka_.
(The format of our PDB-style files is described here.)

Timeline for d1qqka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qqkb_