![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (3 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
![]() | Protein Keratinocyte growth factor, FGF7 [50360] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries) |
![]() | Domain d1qqla_: 1qql A: [25534] Rat FGF7 + human FGF1 chimera |
PDB Entry: 1qql (more details), 2.3 Å
SCOPe Domain Sequences for d1qqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqla_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]} dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn kegklyakqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk ailflplpvss
Timeline for d1qqla_: