Lineage for d1qqla_ (1qql A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401492Protein Keratinocyte growth factor, FGF7 [50360] (1 species)
  7. 2401493Species Norway rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries)
  8. 2401496Domain d1qqla_: 1qql A: [25534]
    Rat FGF7 + human FGF1 chimera

Details for d1qqla_

PDB Entry: 1qql (more details), 2.3 Å

PDB Description: the crystal structure of fibroblast growth factor 7/1 chimera
PDB Compounds: (A:) fibroblast growth factor 7/1 chimera

SCOPe Domain Sequences for d1qqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqla_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
ailflplpvss

SCOPe Domain Coordinates for d1qqla_:

Click to download the PDB-style file with coordinates for d1qqla_.
(The format of our PDB-style files is described here.)

Timeline for d1qqla_: