Lineage for d1qqla_ (1qql A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59853Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 59854Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 59929Protein Keratinocyte growth factor, FGF7 [50360] (1 species)
  7. 59930Species Rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries)
  8. 59933Domain d1qqla_: 1qql A: [25534]

Details for d1qqla_

PDB Entry: 1qql (more details), 2.3 Å

PDB Description: the crystal structure of fibroblast growth factor 7/1 chimera

SCOP Domain Sequences for d1qqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqla_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus)}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
ailflplpvss

SCOP Domain Coordinates for d1qqla_:

Click to download the PDB-style file with coordinates for d1qqla_.
(The format of our PDB-style files is described here.)

Timeline for d1qqla_: