Lineage for d1qqla_ (1qql A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (3 proteins) 
Protein Keratinocyte growth factor, FGF7 [50360] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [50361] (2 PDB entries) 
Domain d1qqla_: 1qql A: [25534]
Details for d1qqla_
PDB Entry: 1qql (more details), 2.3 Å
PDB Description: the crystal structure of fibroblast growth factor 7/1 chimera
SCOP Domain Sequences for d1qqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqla_ b.42.1.1 (A:) Keratinocyte growth factor, FGF7 {Rat (Rattus norvegicus)}
dirvrrlfcrtqwylridkrgkvkgtqemrnsynimeirtvavgivaikgveseyylamn
kegklyakqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
ailflplpvss
SCOP Domain Coordinates for d1qqla_:
Click to download the PDB-style file with coordinates for d1qqla_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qqla_:
- d1qqla_ appears in SCOP 1.57
- d1qqla_ appears in the current release, SCOPe 2.08
View in 3D