SCOPe 2.01: Domain d1rmla_: 1rml A:

Lineage for d1rmla_ (1rml A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (31 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1rmla_: 1rml A: [25533]
   complexed with nts

Details for d1rmla_

PDB Entry: 1rml

PDB Description: nmr study of acid fibroblast growth factor bound to 1,3,6-naphthalene trisulphonate, 26 structures

PDB Compounds: (A:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1rmla_:

Sequence; same for both SEQRES and ATOM records:

>d1rmla_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvssd

Timeline for d1rmla_:

• d1rmla_ first appeared (with stable ids) in SCOP 1.55, called d1rml__
  
• d1rmla_ appears in SCOP 1.75
  
• d1rmla_ appears in SCOPe 2.02
  
• d1rmla_ appears in the current release, SCOPe 2.08