Lineage for d1rml__ (1rml -)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.42: beta-Trefoil [50352] (6 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins) 
Protein Acidic FGF (FGF1) [50357] (3 species) Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries) 
Domain d1rml__: 1rml - [25533]
complexed with nts
Details for d1rml__
PDB Entry: 1rml (more details)
PDB Description: nmr study of acid fibroblast growth factor bound to 1,3,6-naphthalene trisulphonate, 26 structures
SCOP Domain Sequences for d1rml__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rml__ b.42.1.1 (-) Acidic FGF (FGF1) {Human (Homo sapiens)}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvssd
SCOP Domain Coordinates for d1rml__:
Click to download the PDB-style file with coordinates for d1rml__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rml__:
- d1rml__ first appeared (with stable ids) in SCOP 1.55
- d1rml__ appears in SCOP 1.63
- d1rml__ appears in SCOP 1.67
- d1rml__ appears in the current release, SCOPe 2.08, called d1rmla_
View in 3D