Class b: All beta proteins [48724] (141 folds) |
Fold b.42: beta-Trefoil [50352] (6 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (2 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) |
Protein Acidic FGF (FGF1) [50357] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50359] (23 PDB entries) |
Domain d1dzda_: 1dzd A: [25532] |
PDB Entry: 1dzd (more details)
SCOP Domain Sequences for d1dzda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzda_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)} lycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtdgll ygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkailfl plpvssd
Timeline for d1dzda_: