SCOPe 2.05: Domain d1dzca_: 1dzc A:

Lineage for d1dzca_ (1dzc A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1dzca_: 1dzc A: [25531]
   mutant

Details for d1dzca_

PDB Entry: 1dzc

PDB Description: high resolution structure of acidic fibroblast growth factor. mutant fgf-4-ala-(24-154), 24 nmr structures

PDB Compounds: (A:) fibroblast growth factor 1

SCOPe Domain Sequences for d1dzca_:

Sequence; same for both SEQRES and ATOM records:

>d1dzca_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
aaallycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvssd

Timeline for d1dzca_:

• d1dzca_ first appeared (with stable ids) in SCOP 1.55
  
• d1dzca_ appears in SCOPe 2.04
  
• d1dzca_ appears in SCOPe 2.06
  
• d1dzca_ appears in the current release, SCOPe 2.08