SCOPe 2.08: Domain d1e0oc_: 1e0o C:

Lineage for d1e0oc_ (1e0o C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1e0oc_: 1e0o C: [25530]
   Other proteins in same PDB: d1e0ob1, d1e0ob2, d1e0od1, d1e0od2
   complexed with ni, so4

Details for d1e0oc_

PDB Entry: 1e0o, 2.8 Å

PDB Description: crystal structure of a ternary fgf1-fgfr2-heparin complex

PDB Compounds: (C:) fibroblast growth factor 1

SCOPe Domain Sequences for d1e0oc_:

Sequence; same for both SEQRES and ATOM records:

>d1e0oc_ b.42.1.1 (C:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
ailflplpvs

Timeline for d1e0oc_:

• d1e0oc_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0oc_ appears in SCOPe 2.07