Lineage for d1e0oa_ (1e0o A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401199Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2401213Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2401417Domain d1e0oa_: 1e0o A: [25529]
    Other proteins in same PDB: d1e0ob1, d1e0ob2, d1e0od1, d1e0od2
    complexed with ids, ni, sgn, so4

Details for d1e0oa_

PDB Entry: 1e0o (more details), 2.8 Å

PDB Description: crystal structure of a ternary fgf1-fgfr2-heparin complex
PDB Compounds: (A:) fibroblast growth factor 1

SCOPe Domain Sequences for d1e0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0oa_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvs

SCOPe Domain Coordinates for d1e0oa_:

Click to download the PDB-style file with coordinates for d1e0oa_.
(The format of our PDB-style files is described here.)

Timeline for d1e0oa_: