SCOP 1.61: Domain d1evta_: 1evt A:

Lineage for d1evta_ (1evt A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.42: beta-Trefoil [50352] (5 superfamilies)

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)

6. Protein Acidic FGF (FGF1) [50357] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries)

8. Domain d1evta_: 1evt A: [25527]
   Other proteins in same PDB: d1evtc1, d1evtc2, d1evtd1, d1evtd2

Details for d1evta_

PDB Entry: 1evt, 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)

SCOP Domain Sequences for d1evta_:

Sequence; same for both SEQRES and ATOM records:

>d1evta_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvs

Timeline for d1evta_:

• d1evta_ first appeared (with stable ids) in SCOP 1.55
  
• d1evta_ appears in SCOP 1.59
  
• d1evta_ appears in SCOP 1.63
  
• d1evta_ appears in the current release, SCOPe 2.08