Lineage for d1evta_ (1evt A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59853Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 59854Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 59855Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 59869Species Human (Homo sapiens) [TaxId:9606] [50359] (9 PDB entries)
  8. 59883Domain d1evta_: 1evt A: [25527]
    Other proteins in same PDB: d1evtc1, d1evtc2, d1evtd1, d1evtd2

Details for d1evta_

PDB Entry: 1evt (more details), 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)

SCOP Domain Sequences for d1evta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evta_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvs

SCOP Domain Coordinates for d1evta_:

Click to download the PDB-style file with coordinates for d1evta_.
(The format of our PDB-style files is described here.)

Timeline for d1evta_: