Lineage for d1axmf_ (1axm F:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 59853Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 59854Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 59855Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 59869Species Human (Homo sapiens) [TaxId:9606] [50359] (9 PDB entries)
  8. 59882Domain d1axmf_: 1axm F: [25526]

Details for d1axmf_

PDB Entry: 1axm (more details), 3 Å

PDB Description: heparin-linked biologically-active dimer of fibroblast growth factor

SCOP Domain Sequences for d1axmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axmf_ b.42.1.1 (F:) Acidic FGF (FGF1) {Human (Homo sapiens)}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvs

SCOP Domain Coordinates for d1axmf_:

Click to download the PDB-style file with coordinates for d1axmf_.
(The format of our PDB-style files is described here.)

Timeline for d1axmf_: