SCOP 1.59: Domain d1axme_: 1axm E:

Lineage for d1axme_ (1axm E:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.42: beta-Trefoil [50352] (5 superfamilies)

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)

6. Protein Acidic FGF (FGF1) [50357] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (17 PDB entries)

8. Domain d1axme_: 1axm E: [25525]

Details for d1axme_

PDB Entry: 1axm, 3 Å

PDB Description: heparin-linked biologically-active dimer of fibroblast growth factor

SCOP Domain Sequences for d1axme_:

Sequence; same for both SEQRES and ATOM records:

>d1axme_ b.42.1.1 (E:) Acidic FGF (FGF1) {Human (Homo sapiens)}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvs

Timeline for d1axme_:

• d1axme_ first appeared (with stable ids) in SCOP 1.55
  
• d1axme_ appears in SCOP 1.57
  
• d1axme_ appears in SCOP 1.61
  
• d1axme_ appears in the current release, SCOPe 2.08