Lineage for d1axmc_ (1axm C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14402Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 14403Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (3 proteins)
  6. 14404Protein Acidic FGF (FGF1) [50357] (2 species)
  7. 14416Species Human (Homo sapiens) [TaxId:9606] [50359] (9 PDB entries)
  8. 14426Domain d1axmc_: 1axm C: [25523]

Details for d1axmc_

PDB Entry: 1axm (more details), 3 Å

PDB Description: heparin-linked biologically-active dimer of fibroblast growth factor

SCOP Domain Sequences for d1axmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axmc_ b.42.1.1 (C:) Acidic FGF (FGF1) {Human (Homo sapiens)}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpv

SCOP Domain Coordinates for d1axmc_:

Click to download the PDB-style file with coordinates for d1axmc_.
(The format of our PDB-style files is described here.)

Timeline for d1axmc_: