SCOPe 2.06: Domain d2axmb_: 2axm B:

Lineage for d2axmb_ (2axm B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d2axmb_: 2axm B: [25520]
   Heparin-linked biologically-active dimer

Details for d2axmb_

PDB Entry: 2axm, 3 Å

PDB Description: heparin-linked biologically-active dimer of fibroblast growth factor

PDB Compounds: (B:) acidic fibroblast growth factor

SCOPe Domain Sequences for d2axmb_:

Sequence; same for both SEQRES and ATOM records:

>d2axmb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
lflplpv

Timeline for d2axmb_:

• d2axmb_ first appeared (with stable ids) in SCOP 1.55
  
• d2axmb_ appears in SCOPe 2.05
  
• d2axmb_ appears in SCOPe 2.07
  
• d2axmb_ appears in the current release, SCOPe 2.08