Lineage for d2afgd_ (2afg D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464258Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 464259Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 464260Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 464261Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 464275Species Human (Homo sapiens) [TaxId:9606] [50359] (26 PDB entries)
  8. 464307Domain d2afgd_: 2afg D: [25517]

Details for d2afgd_

PDB Entry: 2afg (more details), 2 Å

PDB Description: 2.0 angstrom x-ray structure of human acidic fibroblast growth factor

SCOP Domain Sequences for d2afgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afgd_ b.42.1.1 (D:) Acidic FGF (FGF1) {Human (Homo sapiens)}
pkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdtd
gllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqkai
lflplpvs

SCOP Domain Coordinates for d2afgd_:

Click to download the PDB-style file with coordinates for d2afgd_.
(The format of our PDB-style files is described here.)

Timeline for d2afgd_: