Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein Acidic FGF (FGF1) [50357] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries) |
Domain d1afch_: 1afc H: [25513] complexed with scr |
PDB Entry: 1afc (more details), 2.7 Å
SCOPe Domain Sequences for d1afch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afch_ b.42.1.1 (H:) Acidic FGF (FGF1) {Cow (Bos taurus) [TaxId: 9913]} kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka ilflplp
Timeline for d1afch_: