Lineage for d1afch_ (1afc H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951554Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 951555Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 951556Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 951557Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)
  8. 951567Domain d1afch_: 1afc H: [25513]
    complexed with scr

Details for d1afch_

PDB Entry: 1afc (more details), 2.7 Å

PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor
PDB Compounds: (H:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1afch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afch_ b.42.1.1 (H:) Acidic FGF (FGF1) {Cow (Bos taurus) [TaxId: 9913]}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp

SCOPe Domain Coordinates for d1afch_:

Click to download the PDB-style file with coordinates for d1afch_.
(The format of our PDB-style files is described here.)

Timeline for d1afch_: