Lineage for d1afcg_ (1afc G:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14402Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 14403Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (3 proteins)
  6. 14404Protein Acidic FGF (FGF1) [50357] (2 species)
  7. 14405Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)
  8. 14414Domain d1afcg_: 1afc G: [25512]

Details for d1afcg_

PDB Entry: 1afc (more details), 2.7 Å

PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor

SCOP Domain Sequences for d1afcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afcg_ b.42.1.1 (G:) Acidic FGF (FGF1) {Cow (Bos taurus)}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp

SCOP Domain Coordinates for d1afcg_:

Click to download the PDB-style file with coordinates for d1afcg_.
(The format of our PDB-style files is described here.)

Timeline for d1afcg_: