![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.1: Cytokine [50353] (2 families) ![]() |
![]() | Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) |
![]() | Protein Acidic FGF (FGF1) [50357] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries) |
![]() | Domain d1afcd_: 1afc D: [25509] |
PDB Entry: 1afc (more details), 2.7 Å
SCOP Domain Sequences for d1afcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afcd_ b.42.1.1 (D:) Acidic FGF (FGF1) {Cow (Bos taurus)} kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka ilflplp
Timeline for d1afcd_: