Lineage for d1afcd_ (1afc D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111052Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 111053Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 111054Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 111055Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)
  8. 111061Domain d1afcd_: 1afc D: [25509]

Details for d1afcd_

PDB Entry: 1afc (more details), 2.7 Å

PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor

SCOP Domain Sequences for d1afcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afcd_ b.42.1.1 (D:) Acidic FGF (FGF1) {Cow (Bos taurus)}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp

SCOP Domain Coordinates for d1afcd_:

Click to download the PDB-style file with coordinates for d1afcd_.
(The format of our PDB-style files is described here.)

Timeline for d1afcd_: