Lineage for d1afcd_ (1afc D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (3 proteins) 
Protein Acidic FGF (FGF1) [50357] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries) 
Domain d1afcd_: 1afc D: [25509]
Details for d1afcd_
PDB Entry: 1afc (more details), 2.7 Å
PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor
SCOP Domain Sequences for d1afcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afcd_ b.42.1.1 (D:) Acidic FGF (FGF1) {Cow (Bos taurus)}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp
SCOP Domain Coordinates for d1afcd_:
Click to download the PDB-style file with coordinates for d1afcd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1afcd_:
- d1afcd_ appears in SCOP 1.57
- d1afcd_ appears in the current release, SCOPe 2.08
View in 3D
