Lineage for d1afcc_ (1afc C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375318Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 375319Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 375320Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 375321Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)
  8. 375326Domain d1afcc_: 1afc C: [25508]

Details for d1afcc_

PDB Entry: 1afc (more details), 2.7 Å

PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor

SCOP Domain Sequences for d1afcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afcc_ b.42.1.1 (C:) Acidic FGF (FGF1) {Cow (Bos taurus)}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp

SCOP Domain Coordinates for d1afcc_:

Click to download the PDB-style file with coordinates for d1afcc_.
(The format of our PDB-style files is described here.)

Timeline for d1afcc_: