Lineage for d1afcb_ (1afc B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298063Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 298064Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 298065Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (6 proteins)
  6. 298066Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 298067Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)
  8. 298071Domain d1afcb_: 1afc B: [25507]

Details for d1afcb_

PDB Entry: 1afc (more details), 2.7 Å

PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor

SCOP Domain Sequences for d1afcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afcb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Cow (Bos taurus)}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp

SCOP Domain Coordinates for d1afcb_:

Click to download the PDB-style file with coordinates for d1afcb_.
(The format of our PDB-style files is described here.)

Timeline for d1afcb_: