SCOP 1.67: Domain d1afca_: 1afc A:

Lineage for d1afca_ (1afc A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)

6. Protein Acidic FGF (FGF1) [50357] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)

8. Domain d1afca_: 1afc A: [25506]

Details for d1afca_

PDB Entry: 1afc, 2.7 Å

PDB Description: structural studies of the binding of the anti-ulcer drug sucrose octasulfate to acidic fibroblast growth factor

SCOP Domain Sequences for d1afca_:

Sequence; same for both SEQRES and ATOM records:

>d1afca_ b.42.1.1 (A:) Acidic FGF (FGF1) {Cow (Bos taurus)}
kpkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdt
dgllygsqtpneeclflerleenhyntyiskkhaekhwfvglkkngrsklgprthfgqka
ilflplp

Timeline for d1afca_:

• d1afca_ first appeared (with stable ids) in SCOP 1.55
  
• d1afca_ appears in SCOP 1.65
  
• d1afca_ appears in SCOP 1.69
  
• d1afca_ appears in the current release, SCOPe 2.08