Lineage for d1bara_ (1bar A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14402Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 14403Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (3 protein domains)
  6. 14404Protein Acidic FGF (FGF1) [50357] (2 species)
  7. 14405Species Cow (Bos taurus) [TaxId:9913] [50358] (2 PDB entries)
  8. 14406Domain d1bara_: 1bar A: [25504]

Details for d1bara_

PDB Entry: 1bar (more details), 2.7 Å

PDB Description: three-dimensional structures of acidic and basic fibroblast growth factors

SCOP Domain Sequences for d1bara_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bara_ b.42.1.1 (A:) Acidic FGF (FGF1) {Cow (Bos taurus)}
pkllycsnggyflrilpdgtvdgtkdrsdqhiqlqlaaesigevyikstetgqflamdtd
gllygsqtpneeclflerleengyntyiskkhaekhwfvglkkngrsklgprthfgqkai
lflplpv

SCOP Domain Coordinates for d1bara_:

Click to download the PDB-style file with coordinates for d1bara_.
(The format of our PDB-style files is described here.)

Timeline for d1bara_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1barb_