Lineage for d1blda_ (1bld A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2384843Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2384844Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 protein domains)
  6. 2385080Protein Basic FGF (FGF2) [50355] (1 species)
  7. 2385081Species Human (Homo sapiens) [TaxId:9606] [50356] (20 PDB entries)
  8. 2385111Domain d1blda_: 1bld A: [25503]
    mutant

Details for d1blda_

PDB Entry: 1bld (more details)

PDB Description: basic fibroblast growth factor (fgf-2) mutant with cys 78 replaced by ser and cys 96 replaced by ser, nmr
PDB Compounds: (A:) basic fibroblast growth factor

SCOPe Domain Sequences for d1blda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blda_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
maegeittlpalpedggsgafppghfkdpkrlycknggfflrihpdgrvdgvreksdphi
klqlqaeergvvsikgvsanrylamkedgrllasksvtdecffferlesnnyntyrsrky
tswyvalkrtgqyklgsktgpgqkailflpmsaks

SCOPe Domain Coordinates for d1blda_:

Click to download the PDB-style file with coordinates for d1blda_.
(The format of our PDB-style files is described here.)

Timeline for d1blda_: