Lineage for d1fq9a_ (1fq9 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111052Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 111053Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins)
  6. 111110Protein Basic FGF (FGF2) [50355] (1 species)
  7. 111111Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries)
  8. 111135Domain d1fq9a_: 1fq9 A: [25500]
    Other proteins in same PDB: d1fq9c1, d1fq9c2, d1fq9d1, d1fq9d2

Details for d1fq9a_

PDB Entry: 1fq9 (more details), 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex

SCOP Domain Sequences for d1fq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9a_ b.42.1.1 (A:) Basic FGF (FGF2) {Human (Homo sapiens)}
hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
ailflpmsa

SCOP Domain Coordinates for d1fq9a_:

Click to download the PDB-style file with coordinates for d1fq9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fq9a_: